PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun002040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 324aa    MW: 36832.5 Da    PI: 4.4631
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-13531PU_refplantGDBView CDS
gnl|UG|Vun#S45792302PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.82.1e-1982135356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k+++++++q++ Le+ Fe+++++  e++++LAk lgL+ rqV +WFqNrRa++k
  Vun002040  82 KKRRLSANQVQFLEKSFEEENKLEPERKTKLAKDLGLQPRQVAIWFQNRRARWK 135
                56689************************************************9 PP

2HD-ZIP_I/II128.92.1e-4181173193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekkrrls++qv++LE+sFeee+kLeperK++la++Lglqprqva+WFqnrRAR+ktkqlEkdye L+++y++lk++ e+L ke+++L++e+++
    Vun002040  81 EKKRRLSANQVQFLEKSFEEENKLEPERKTKLAKDLGLQPRQVAIWFQNRRARWKTKQLEKDYEILHESYESLKANYENLLKEKDKLKSEVAH 173
                  69**************************************************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.17E-1969139IPR009057Homeodomain-like
PROSITE profilePS5007117.6777137IPR001356Homeobox domain
SMARTSM003897.2E-1980141IPR001356Homeobox domain
PfamPF000461.1E-1682135IPR001356Homeobox domain
CDDcd000862.24E-1782138No hitNo description
Gene3DG3DSA:1.10.10.603.2E-2084144IPR009057Homeodomain-like
PRINTSPR000311.3E-5108117IPR000047Helix-turn-helix motif
PROSITE patternPS000270112135IPR017970Homeobox, conserved site
PRINTSPR000311.3E-5117133IPR000047Helix-turn-helix motif
PfamPF021837.7E-15137178IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MAAGRAFSDI TAFLRNQTPP PTSQPLDSLF LSSSTAPFLG SRSMMSFEGE GGKGCNGSFF  60
RAFDIDENGD ECMDEYFHQP EKKRRLSANQ VQFLEKSFEE ENKLEPERKT KLAKDLGLQP  120
RQVAIWFQNR RARWKTKQLE KDYEILHESY ESLKANYENL LKEKDKLKSE VAHLSEKVLA  180
REKEEGQLKQ AESGAKRLQE QDQEAPQRPV LESVSEGEGS KVSCVVGGCK QEDISSARSD  240
ILDSDSPHYT DGVHSAVLEH GDSSYVFEPD QSDMSQDEED NLSKSLYPSY LFPKLEDADY  300
SDPTESSCNF GFSEEDHALW NWEY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1129137RRARWKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014510539.10.0PREDICTED: homeobox-leucine zipper protein HAT5-like
TrEMBLA0A0L9TRN40.0A0A0L9TRN4_PHAAN; Uncharacterized protein
TrEMBLA0A0S3R7P10.0A0A0S3R7P1_PHAAN; Uncharacterized protein
STRINGGLYMA05G01390.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.11e-45homeobox 1